PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00069.209
Common NameAMTR_s00069p00196720, LOC18447871
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRF
Protein Properties Length: 230aa    MW: 25254.6 Da    PI: 8.758
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00069.209genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.51.2e-23122161140
                                       WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsr 40 
                                               ++epgrCrRtDGKkWRCsr+v++++k+C+rH+hrgrsr+ 
  evm_27.model.AmTr_v1.0_scaffold00069.209 122 EPEPGRCRRTDGKKWRCSRDVVPDHKYCDRHIHRGRSRKP 161
                                               69*********************************99975 PP

2QLQ50.18.3e-185892337
                                       QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                                              FT  Qlq+L++Q+l++Ky++a++PvP +L+++i+k
  evm_27.model.AmTr_v1.0_scaffold00069.209 58 FTFLQLQELEQQALIFKYMNAGLPVPLQLVFPIWK 92
                                              9999*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.4E-75692IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.0225792IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.0E-135891IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.468122166IPR014977WRC domain
PfamPF088797.8E-20123160IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MATQEHHSHP SRLTHFELDA PASKVPRTNC GGEEETVRLG HGLGLGLGLG LGTGRYCFTF  60
LQLQELEQQA LIFKYMNAGL PVPLQLVFPI WKSIVGSPKA IYCPPIFGGG LCFEYRNRMN  120
PEPEPGRCRR TDGKKWRCSR DVVPDHKYCD RHIHRGRSRK PVEHQTINNT LTLSTQEGTQ  180
FQAQSQPTEP MKGSGHRLSF SFGPVAPTGT QAVSENSNGG ASKVDSCGI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006858019.11e-172PREDICTED: growth-regulating factor 10
TrEMBLU5D1I81e-172U5D1I8_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.16e-28growth-regulating factor 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]